PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0521s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 1139aa    MW: 127519 Da    PI: 6.597
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0521s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3733.6e-23126227199
                             EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                             f+k+lt sd++++g +++p++ ae++      +++++  ++l+ +d++ +sW++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+
  SapurV1A.0521s0030.1.p 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfSMQPPA-QELVARDLHDNSWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVL 211
                             99*****************************9445444.38********************************************** PP

                             EEE-SSSEE..EEEEE-S CS
                      B3  82 Fkldgrsefelvvkvfrk 99 
                             F   ++++ +l+++++r+
  SapurV1A.0521s0030.1.p 212 FI--RDEKSQLLLGIRRA 227
                             **..45677789999997 PP

2Auxin_resp123.31.7e-40252334183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             aahaa+++s+F+++YnPras+seFv++++k++ka++++vs+GmRf+m+fete+s  rr++Gt++g+sd+d+vrW+nS+Wr+L+
  SapurV1A.0521s0030.1.p 252 AAHAAANNSPFTIFYNPRASPSEFVIPFSKYNKAMYTQVSLGMRFRMMFETEESGVRRYMGTITGISDMDQVRWKNSQWRNLQ 334
                             79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-44116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.6E-42118241IPR015300DNA-binding pseudobarrel domain
CDDcd100175.52E-20125226No hitNo description
PfamPF023622.4E-21126227IPR003340B3 DNA binding domain
PROSITE profilePS5086312.407126228IPR003340B3 DNA binding domain
SMARTSM010192.7E-24126228IPR003340B3 DNA binding domain
PfamPF065077.8E-36252334IPR010525Auxin response factor
PfamPF023093.0E-99771066IPR033389AUX/IAA domain
PROSITE profilePS5174523.89801073IPR000270PB1 domain
SuperFamilySSF542772.55E-79951058No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1139 aa     Download sequence    Send to blast
MKVPSNGFLP NFAEGERKCI NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKE  60
TDFIPSYPNL PSKLICMLHN VTLHADVETD EVYAQMTLQP VSKYEKEALI ASDMGLKQNR  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQELVARD LHDNSWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFIRDEKSQL LLGIRRANRQ QPALSSSVIS  240
SDSMHIGILA AAAHAAANNS PFTIFYNPRA SPSEFVIPFS KYNKAMYTQV SLGMRFRMMF  300
ETEESGVRRY MGTITGISDM DQVRWKNSQW RNLQVGWDES TAGERPSRVS IWEIEPVVTP  360
FYIYPPPFFR PKFPKQPGMP DDESDIENAF KRAMPWLGDE FGMKDPPSSI FPGLSLVQWM  420
SMQQNNQFPA AQSGFFPSMV PSNALHNNLG TDDPSKLLNF QAPGLSPPSV QFNKTNPQNQ  480
VGQLPQPPMA WTQQQQLQQL LQNPIPQHQQ QPPYPQQQQQ PPYPQQQQQQ HWPQQQPQQQ  540
QTRQPPPQIQ QHQQQQQIFQ PPTLNERAVS PNQIPNQNLQ HPVLYSHLQQ QQQQQQHLLA  600
SNTQSQSIPS ANKSSYQLTS FPQDSQLHQQ MEQQSNLSQR KQQQTQSQPS PLLLLQQNLS  660
QRPQPQQQQS QPSHSEQQLH LQLLQKLQQQ QQQQQLPSPA SSVLQSQQLQ QQQTHQQHQQ  720
LQQSPLSQNQ QPHGSNSFST AAIMRTQSFP MNQPQGLQKP PMAVRAHSNI TDGEAPSCST  780
SPSTNNCQIS PPNFLNRNQL APAMLIGDSA IEPAGNIIQD LQSKSDIHVK NEFPSSRGLD  840
QLKYKGVVTD QLEASSSGTS YCLDAGNIQQ NFSVPAFGLD GDVQSHPRNS LPFASSIDAL  900
EPDILLSREY DSQKDLQNLL ANYGGTARDI ETELSTAAIS SQSFGVPNIP LKPGCSNDVA  960
INDTGVMNNG LWTNQTQRMR TYTKVQKRGS VGRSIDVTRY KGYNELRHDL ARMFGIEGQL  1020
EDPQSSDWKL VYVDHENDIL LVGEDPWEEF VSCVQNIKIL SSAEVQQMSL DGDLGSRAPA  1080
TDVVLGARAV DFPSAIIPQI LAPLLQLLPS DGGFPHITTT SSSTLDYIRQ RGQEAKDP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1701535545388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003609970.10.0auxin response factor 2
TrEMBLG7JS690.0G7JS69_MEDTR; Auxin response factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49183352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19